PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_006386-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 310aa    MW: 35144.2 Da    PI: 5.725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_006386-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.9e-133881144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g+W +eEd+ l++ v+++G+++W++I ++  + Rt+k+c++rw
  AHYPO_006386-RA 38 KGPWKAEEDQVLLKHVQKYGPRDWSSIRSKGLLQRTGKSCRLRW 81
                     79*************************8887799********** PP

2Myb_DNA-binding34.16.5e-1181116744
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +E++  +d  ++ G++ W++Ia +++ gRt++++k++w
  AHYPO_006386-RA  81 WEEKVVIDMQAEIGNK-WARIATYLP-GRTDNDVKNFW 116
                      8***************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4313389IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-173682IPR009057Homeodomain-like
SuperFamilySSF466892.97E-2237116IPR009057Homeodomain-like
SMARTSM007171.7E-1137122IPR001005SANT/Myb domain
PfamPF002493.2E-113881IPR001005SANT/Myb domain
CDDcd001671.23E-104081No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1283118IPR009057Homeodomain-like
PROSITE profilePS500906.08686120IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MRSSKRNYYQ NNSHNYCISR SSSSSSNSGE GKEIVLRKGP WKAEEDQVLL KHVQKYGPRD  60
WSSIRSKGLL QRTGKSCRLR WEEKVVIDMQ AEIGNKWARI ATYLPGRTDN DVKNFWSSRQ  120
KRLARLLVSQ NNPRTKKRKS SPIDTANSSQ VAKNCSTSVG ETSTNTQSQI ISYPGSTDNN  180
CLSIEPTIVT DCLEPIPLTQ EDNNPNYPNL FLSEEEICFP SIPYNQTDLM FVPETQEIID  240
SLDYSFFNPF EYSHNPVAFV NDGTHFPPCS LGCDLSVETT TETLKTENLG ISNCLWDDIP  300
LDMFDHQFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-233612225126MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692444.15e-76PREDICTED: transcription factor WER
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.19e-52MYB family protein